Information for Lmscaffold113.143

· Gene Ontology:


GO:0003677


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


B3/PF02362


· Interpro information:


Lmscaffold113.143


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000.287151


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (202 aa)


>Lmscaffold113.143
MNKGSSSYDVIPKFFKVYLPGDSRDDLELPISFNSHLPNYQPKNITLRGSHGNIWEMALRKCGGEKYVMVNGWKMILENEDLKGGDFLAFEFDGSQCFNFCIYEPDTMCKKLRRNSLVPARVIKDYDLHFPESITLIDPLVKKFGPLEKKMKIQTNGSVFVKGFGSVIRRNKVKTTDKMIFEIKKKGNNNLVHTIKIHIVSG


· CDS sequence: (609 bp)


>Lmscaffold113.143
ATGAATAAAGGAAGCTCTTCGTACGATGTTATACCAAAATTCTTCAAAGTTTACTTACCTGGGGATTCTAGAGATGATCTGGAATTACCCATTTCTTTCAATAGCCATTTACCAAATTATCAGCCTAAAAACATAACTCTTAGAGGCTCACATGGAAACATTTGGGAAATGGCTTTGAGGAAATGTGGTGGTGAGAAATATGTCATGGTTAATGGGTGGAAAATGATTTTAGAGAATGAAGATCTCAAAGGTGGAGACTTCTTGGCTTTCGAGTTTGATGGCTCTCAGTGTTTCAATTTCTGTATCTACGAGCCGGACACAATGTGTAAAAAGCTTCGAAGAAATTCACTCGTCCCAGCTCGGGTTATAAAAGACTATGACTTACACTTCCCTGAGAGCATTACTCTCATCGACCCACTCGTGAAGAAATTTGGTCCATTGGAGAAGAAAATGAAGATTCAGACGAATGGCAGTGTGTTTGTCAAAGGATTTGGAAGTGTTATCAGACGTAATAAGGTGAAGACAACTGATAAAATGATATTCGAGATAAAGAAGAAAGGTAATAATAATCTGGTTCATACAATCAAGATCCACATTGTTAGTGGCTGA


· Genomic location:


scaffold113:804553:805788:-