Information for Lmscaffold146.31

· Gene Ontology:


no information


· KEGG information:


K00430: E1.11.1.7; peroxidase


· Enzyme Commission number (EC):


[EC:1.11.1.7]


· Gene family:


PCEsterase/PF13839; Alba/PF01918; peroxidase/PF00141; UPF0052/PF01933; Inhibitor_I29/PF08246; Pkinase/PF00069; DUF688/PF05097; Kinaselike/PF14531; S1FA/PF04689; zfDof/PF02701; NAF/PF03822; Peptidase_C1/PF00112; Pkinase_Tyr/PF07714


· Interpro information:


Lmscaffold146.31


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
21.061320.196618.795916.967


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (182 aa)


>Lmscaffold146.31
MTNAKPFCLFGFFFLLLQLFSIFHIAVSWLRNLFHDCVVKSCDASLLLETARGVESEQKSIRSFGMRNFKYVKVIKDALEKECPSTVSCADIVALSARDGIVMIVAMSSEGSAGKAAVEAKGLNPGLIVLLVVGGLLVTFLIANYVMYMYAQKNLPPKKKKPISKKKLKREKLKQGVPVPGE


· CDS sequence: (549 bp)


>Lmscaffold146.31
ATGACCAATGCAAAGCCCTTCTGCCTCTTCGGCTTCTTTTTTCTGTTATTACAGTTATTCTCCATCTTCCATATCGCTGTCTCTTGGCTCCGTAATCTCTTCCATGACTGTGTCGTCAAGTCGTGTGATGCGTCGCTGTTACTAGAGACGGCTCGAGGTGTAGAATCAGAGCAGAAATCGATTAGAAGTTTCGGTATGAGAAATTTCAAATACGTTAAAGTTATCAAAGACGCACTCGAGAAAGAATGTCCTTCTACTGTCTCTTGTGCTGATATTGTTGCTCTCTCTGCTAGAGACGGTATTGTCATGATCGTAGCCATGAGCAGTGAAGGTTCCGCCGGAAAGGCGGCTGTTGAAGCCAAAGGATTGAACCCAGGATTGATAGTGCTGCTTGTTGTTGGAGGTCTGCTTGTGACATTCCTGATAGCCAATTACGTGATGTACATGTATGCTCAGAAGAATCTACCCCCGAAGAAGAAGAAGCCCATCTCCAAAAAGAAGCTCAAGCGTGAGAAGCTGAAGCAAGGAGTTCCAGTGCCTGGTGAATAG


· Genomic location:


scaffold146:225378:228293:+