Information for Lmscaffold17.257

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


bZIP_C/PF12498; bZIP_1/PF00170; bZIP_Maf/PF03131; bZIP_2/PF07716


· Interpro information:


Lmscaffold17.257


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0.3794150.3789661.625620.945199


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (388 aa)


>Lmscaffold17.257
MKSVFSVDDLTDSLWPSPASTPTQSPMTKSQSEWSFQRLLEDISVSSGSTFSSSSATDNVIGLSSPQLQSELSVSKPEEVAASDIANVFDTQKPQVNAEIDPNHYQAILKSKLHLACAAIALRVAAYVKAEDSSASSGNQKQPPSIGSQIHGPAATQIPSVSTSPSLDTHIKPDIQIRQGTSVSPRDYSDEEDFEGDTETTENADPADLKRIRRKLSNRESARRSRRRKQEHMNELDAQVGQLRTQHTTLLSRLRDIKHKYDTAAVDNRILKADIETLRTKVKMAEDTVKRVTRMHPLVLGRPKSIPFNSTPTDSSQINHTPNLADSITTGMIPNQRIENKNNFENNTVVPLNMSPESNIGLKNSTKAPLPQNIALSNRLLEQVDPFV


· CDS sequence: (1167 bp)


>Lmscaffold17.257
ATGAAGAGTGTTTTCTCCGTCGATGATTTAACTGATTCTCTCTGGCCATCTCCGGCGTCAACTCCGACTCAATCTCCGATGACTAAAAGTCAATCGGAGTGGTCGTTTCAGAGACTGCTTGAAGATATTTCCGTTTCTTCAGGGAGTACTTTTTCCTCATCTTCTGCGACGGATAACGTAATCGGACTGTCATCTCCACAGCTTCAATCTGAGCTGTCCGTTTCGAAACCAGAAGAAGTTGCTGCATCTGACATTGCTAATGTCTTCGATACACAGAAGCCACAAGTTAATGCTGAGATTGATCCTAACCACTATCAAGCGATTCTCAAGAGCAAACTCCATCTCGCTTGCGCTGCTATTGCACTTCGTGTGGCAGCATATGTGAAGGCTGAGGATTCGAGTGCCTCATCTGGTAATCAAAAGCAGCCTCCTTCTATTGGATCTCAAATTCATGGTCCTGCTGCGACGCAAATTCCATCTGTTAGCACTTCTCCTTCATTAGACACACATATTAAACCAGATATTCAGATCAGACAAGGTACCAGTGTTTCACCGCGAGATTATTCAGATGAAGAAGATTTTGAAGGAGACACAGAAACAACAGAGAATGCTGATCCTGCTGATTTAAAGCGCATTAGGAGGAAGCTTTCAAACCGAGAATCTGCTAGGCGTTCTAGAAGAAGAAAGCAAGAACATATGAATGAACTTGATGCACAGGTTGGGCAATTACGAACTCAGCATACAACATTGCTTAGTCGTCTCAGAGACATAAAACATAAGTATGATACAGCTGCTGTTGATAACAGAATCTTAAAAGCTGATATCGAAACACTGAGAACAAAGGTGAAGATGGCTGAGGATACTGTGAAAAGAGTGACAAGAATGCACCCTTTAGTTTTGGGAAGACCAAAGAGCATACCATTCAATAGCACACCGACAGATTCTTCACAGATAAACCACACTCCGAATCTAGCAGACTCAATTACGACCGGTATGATTCCAAATCAGAGAATAGAGAACAAGAACAACTTTGAAAACAACACTGTTGTTCCTTTAAATATGAGTCCAGAGAGCAATATTGGATTGAAAAACTCGACCAAGGCGCCTCTTCCACAAAATATTGCCCTATCCAATCGTTTGCTTGAACAGGTGGACCCATTTGTTTGA


· Genomic location:


scaffold17:1407601:1409674:-