Information for Lmscaffold18.472

· Gene Ontology:


GO:0003677 GO:0005634 GO:0006355


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


S1FA/PF04689


· Interpro information:


Lmscaffold18.472


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
283.521340.054239.874283.457


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (76 aa)


>Lmscaffold18.472
MSSKGSAGKTAVEAKGLNPGLIVLLVIGGLLVTFLIANYVMYMYAQKNLPPKKKKPISKKKLKREKLKQGVPVPGE


· CDS sequence: (231 bp)


>Lmscaffold18.472
ATGAGCAGTAAAGGTTCTGCCGGAAAGACAGCTGTTGAAGCCAAAGGATTGAACCCAGGATTGATAGTGCTACTTGTTATTGGAGGTCTGCTTGTGACGTTCCTGATAGCCAATTACGTGATGTACATGTATGCTCAGAAGAATCTACCCCCAAAGAAGAAGAAGCCCATCTCCAAAAAGAAGCTCAAGCGTGAGAAGCTGAAGCAAGGAGTCCCTGTGCCGGGTGAATAG


· Genomic location:


scaffold18:4566319:4567180:-