Information for Lmscaffold237.82

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


Peptidase_M16_M/PF16187; Peptidase_M16_C/PF05193; LRR_2/PF07723; PPR_1/PF12854; Nt_Gln_amidase/PF09764; DUF642/PF04862; FBD/PF08387; PPR/PF01535; Gelsolin/PF00626; PPR_long/PF17177; PPR_3/PF13812; VHP/PF02209; PPR_2/PF13041; DUF288/PF03385; Peptidase_M16/PF00675; DTW/PF03942


· Interpro information:


Lmscaffold237.82


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (168 aa)


>Lmscaffold237.82
MRKPHGHKLTEEQINLAGMRTLSDEQKAEEERYDVSTELTLYTDPWTIKKTLTASDLGGNSRLILHTNLVERKIIRYLHENDQHMIQEGLSITVNVFDHDTQKTFLLLFKRYACSGSYVLNGEWRSSFVRRRNLRIGDQIGLFWDRYDQKFHFCVLSRAATQVPKNPN


· CDS sequence: (1272 bp)


>Lmscaffold237.82
ATGGCGTCGATGTCGTCGTCAGATCACGGACCTAAGACAGAGGCGGGATGCAGTGGAAGAGGTGGAGGAGAGAGTCCGGAGACTGTGGCGGCTAGTGATCAGGTGTTGTATAGAGGTTTTAAGAAGGCGAAGGAGAGAGGTTGTACAGCTAAAGAACGTATTAGTAAAATGCCGCCGTGTACCGCTGGCAAAAGGAGTTCCATATACCGTGGAGTCACCAGGCATAGATGGACAGGTCGTTATGAAGCTCACCTTTGGGATAAAAGTACTTGGAACCAAAACCAGAACAAAAAGGGGAAACAAGGAGCATATGATGATGAAGAGGCTGCTGCTAGAGCTTATGACCTTGCTGCCTTAAAATATTGGGGCCCTGGGACACTTATAAATTTTCCGGTGACTGACTACACCAGAGATTTGGAAGAAATGCAAAATCTCTCTAGGGAAGAATACCTTGCATCGCTACGTAGAAAAAGCAGCGGTTTCTCAAGGGGAATAGCGAAATATCGTGGACTTCAAAGCCGATGGGATGCATCAGCCAGTCGTATGCCTGGACCTGAATACTTTGCTGGTAGCATTCATTACGGGGCAGGTGAAGGTCGAGGAACAGAAGGTGACTTTCTAGGTAGCTTTTGTCTGGAAAGAAAGATTGATCTAACAGGATACATAAAGTGGTGGGGAATTAACAAAACCCTTCAACCAGAATCTTCATCAAAAGTATCAGAGGATGTAAAGGTCGAAGACGCTGGTACTGAGCTGAAAACACTGGAACACACATCCCAGGCAACAGAACCATACAAGGCGCCAACCCTTGGCATCCTTCGTGGCACTCAGAGAAAAGAAAAAGAATTATTATCACCATCAACCTCGTCTGCTTTAAGCATCTTGTCTCAGTCGCCTGCCTACAAGAGCCTGGAGGAGAAAGTGCTGAAGATCCAAGAAAGCAGCACTAAAGAAAACGATGAGAATGCAAATCGTAACATCATCAATACGGAGAAGAATCACGGCAAGGCAATCGAGAAACCAGTTGTGAGTCAAGGAGTTGCTTTGGGCGGTGGTGGTGCTGCTGCTGCTGCTTTGTCTCTTCAGAAAAGCATGTACCCACTTACCTCTCTCTTAACTGCTCCATTGCTCACCAACTACAACACTTTGGATCCTCTAGCAGACCCTATTCTCTGGACACCCTTTCTTCCTTCAGGATTCTCTCATACTTCAGAGGTAACAAAGACAGAGACGAGCTGTTCAACGTACAGCTACCTCCCACTAGAGAAGTGA


· Genomic location:


scaffold237:426618:427124:+