Information for Lmscaffold242.50

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


Myb_DNAbind_6/PF13921; Ribosomal_S24e/PF01282; Pkinase/PF00069; DSPc/PF00782; FLO_LFY/PF01698; mRNA_cap_enzyme/PF01331; mRNA_cap_C/PF03919; Y_phosphatase2/PF03162; DUF868/PF05910; Myb_DNAbind_4/PF13837; Pkinase_Tyr/PF07714


· Interpro information:


Lmscaffold242.50


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (419 aa)


>Lmscaffold242.50
MDPQGFASGLFRWNPTRAIVQAPPPVHLPQQQPAPTPQTAAFGMRLGGLEGLFGPYGIRFYTAAKIAELGFTASTLVDMKDEELEEMMNSLSHIFRWELHVGERYGIKAAVRAERRRLQEEEQEEAPRRRHLLLSAAGDSGAHHALDALSQEGLSEEPVQQQDQTDGAGNNGGGDGGGNWEVRKIKKQQQQQRRRKKTMMMTSVETDDDGNEGEDDDGMVHNGNGSGVLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLIQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAVAATAALVGGISCSGSSASGHGGDDMHY


· CDS sequence: (699 bp)


>Lmscaffold242.50
ATGGGTGGTCGTAAACCATGTTGTGATGAGGTTGGATTGAGAAAGGGTCCATGGACACTGGAAGAAGATGGGAAACTAGTTGATTTCTTAAGGACACGTGGCAGCTGCAACGGAGGAGGATGGTGCTGGAGGGATGTACCGAAACTGGCGGGGCTAAGACGGTGCGGCAAGAGTTGCCGTCTCCGGTGGACTAATTATCTCCGGCCAGATCTCAAGAGAGGTCTTTTTACTGAAGACGAAATCCAACTAGTCATTGATCTTCATTCTCGTCTTGGCAATAGATGGTCGAAGATTGCAGCAGAGTTACCAGGAAGAACAGATAACGATATAAAGAACTATTGGAACACTCATATAAAGAGGAAGCTTATAAGAATGGGTATTGATCCAAACACACATCGTCCGTTTGACCAGCAAAAAGGCAACGAGGAGGATAAGATATCAAAACATCATCTTTGTGATCAGTCAGAGATACCTCCGGTTATAAGGAATGACACGTCAGCAGTGTTATTAAGGAACGGCGACGATCAGCCATGGAGCTTTTTGATGGAAAATGATGGAAGAGGAAGTGGCGCCGGAGAGCTTACGATGCTATTGTCCGACGACATTACGTCAGCATGTTCATCTTCTTCGTCATCGTTGTGGTTAAAGTATGAAGATTTGCGTTATGAAGATTTCGAACTTGGGTGTTTCGATGAGTAG


· Genomic location:


scaffold242:291690:294284:-