Information for Lmscaffold266.278

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


B3/PF02362


· Interpro information:


Lmscaffold266.278


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (358 aa)


>Lmscaffold266.278
MDNFLPFSSNSNANSLPELSMDCNSNPSLYSTIPAYDQAQPQHLLLPYSYSVEQTVMNPHEAFPQIPGMQTGIEFGSLVCNPGLRLERGGFHDPHMKKMARINRKNAMIRSRNNPSPSSSANEYLEARKHVMLNFKKNDEPTVDKKDLYLYSSFDNKKLRVLLVKHLKNSDVGALGRIVLPKRDAERNLPELTDKEGIVVEMRNVDSIQSWSFKYKFWSNNKSRMYVLENTGDFVRSNAAEIGDYLTIYEDESKNLYFSIKKSDQQNEGRENESREVNEMNQHEEMVFDYMIPRDEEEASIAMLIGNLNDHYYPIPNDLMGLTIDHQATSSSQPVDHVHIPHHVGSSHDHVTLDDFQW


· CDS sequence: (900 bp)


>Lmscaffold266.278
ATGCAGAGCAAGAACATGATCGTGACTTCATCACATCAGCAACAACAACAACCACAGCAACCTCAACCACAACTTAAATGCCCTCGTTGTGATTCCTCCAACACAAAGTTCTGTTACTACAACAACTACAGTCTCTCTCAGCCTCGGCACTTTTGCAAGGCATGCAAGAGGTACTGGACTCGAGGTGGGACTCTCCGGAACGTTCCTGTAGGTGGTAGCTACAGGAAGAACAAACGTGTGAAGCGGCCATCAACCGCAACCGCAACGACTGCCTCTACAGCCTCAACTACGACTTCTTCATCTCTTACAAACCCTCATCAGATCTCTCATTTCTCTTCCATGAATCATCATCCTTTGTTCTATGGTTTGTCAGATCATATGAGTAATCTTCCAATGATTCCAAGCCGTTTTAGCGATTCTTCAAAGACTTCTTCATCAAATGGTTTAGAGAGTGAGTGTCTCTCATCTGGGTTTAACAGTCTTAATGCCCTTGGATTAGGGCTTCCACATCATATGAGTCATGACCACAGCTTCATCAACAACTCCACCACAAACAAACCCTTTCTTCTATCAGGTCTATTTGGGTCTTCTTCTTCCTCTACTCTTTTCCAACACCCACAAAAGCCCATGAACAATGGTGGTGATATGTTGGGACAATCCCATCTCCAAACCCTAGCATCCCTTCACGATCTGCATGTTGGAGGTAACAATGAAGATATGAACAAAGAAGGAAAACTTGATCATCAGATCTCTGGGAACATTAATGAGTTCATGTCATCATCATCATCTATGGAGCCTTCAAACTACAACAACATGTGGAGTAATGCAAGTGTTGTCAATGGAGCATGGCTCGATCCAACAAATAATAACGTTGGATCCTCTCTCACCTCTTTGATATAA


· Genomic location:


scaffold266:1681820:1685653:+