Information for Lmscaffold275.27

· Gene Ontology:


GO:0003700 GO:0006355


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


bZIP_1/PF00170; bZIP_2/PF07716


· Interpro information:


Lmscaffold275.27


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (252 aa)


>Lmscaffold275.27
MWWLRELVQVPNPAIFRVFVLSSLATFTSGLALTLEWSCHGKYHTGFRWIVYYGLFLMFLPLLILMVLRILKAKSATSRGSNQTADSARNKEPCVVQSQCTEKTQPTEETETNNCQSLAVVVALDEKQTPPKIKRAVSFPSHGKSFNSRILANRETAKRSKQRKSQYIISLENKVATLSNENASLIISEKRCQALELRIRDSDIKRLNGKIMNQRLTSEMQQQNVTTYEEMQMNNQLDCSEEVEMASASSKF


· CDS sequence: (681 bp)


>Lmscaffold275.27
ATGTATCCTGGAGACAATGAAGCTGGTAAGAGAACTGTTGGTCCATTCTCGAAGACACCATTGATCCGTTATCCAGCTGGTTCACCAGATTTCAGTCCTGGACCACGTGCACCACTGACTCAACCATCGTCTCAGGAACCAATGGAGGAGTCTGATGAGATTATCAAACTGAATGAAGAAGAGAATGGAAATGAACAGACTAATTTGGGTGTGAAGAGAAGAGCAGAGAATAATATAGATCCATTACCAAAATCAAACAACATAAGTGCTTCAAAGGATAAACCTTATACTCCACAAGAACTGCAGCAGATCTCAACCTGCAAGAGACTTAAAGGACTTGCATCTGATCCTAAGAAAGTCAGAAGGATCTTAGCAATGCGAAAGACAGCTAAACGTTCAGAGCAGAGAAAGTCACAGTACATAATTGATTTGGAAACCAAAGTTGCAACTCTTTCGAATGAGAATGCTTCAATTAAAATTAAGCTCGCCATTTCAGAGAAACGATGTCAAGCTTTGGAGCAAAGGATACGAGATTCTAACAATTCAAAAATGCAGCAACTGATTGTGGCAACAGATGAAGAGATGCAAAGGAACAACCAATTTGACGAACAAAACATGTGGAATCAATCCAGCATCAATGAGTTCAATCAGGAATTCGAGAATTCGAATGGACAGTTCTAA


· Genomic location:


scaffold275:238763:240931:-