Information for Lmscaffold291.331

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


B3/PF02362


· Interpro information:


Lmscaffold291.331


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
00.51307900


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (149 aa)


>Lmscaffold291.331
MASSDILPRFFSIYISQYSSNSLMIPCSYYEHLPRRLPKTAILMGAGGKVSKVAMMSKRDKVYFEQGWGTFVTDNELKDGVFLAFLFDGHQRFEVSIYGHGGCKEIRVVIDVQEISDDDTEESLHSINIIDDETEIIRDILLITLTQPL


· CDS sequence: (1248 bp)


>Lmscaffold291.331
ATGTCGTGCTGCTTGGCTTCGTGCTGTGCCTCCGCGACTTGTGGGTTATGCTCGTCGGTGGCATCGGGGATTACGAGGAAATCGGCGAGAATTGCTTATTGTGGTCTCTTTGGAGCATCTCTTGTCGTCTCCTGGATTCTTCGTGAGACCGGAGCTCCGCTCCTCGAGAAACTCCCATGGATAAACACTTCCGATTCATATACTAAAGAATGGTATCAGCAGCAAGCTGTTCTTCGTGTGAGTTTTGGGAATTTCCTCTTCTTTGCAATATATGCTTTGATCATGGTTGGTGTGAAGGACCAGAACGACAGGCGTGACTCGTGGCACCATGGCGGGTGGGGTTTGAAAATGATCGTCTGGTTTTTGCTTGTTGTCCTCATGTTTTTTGTTCCAAATGTTATTGTCTCAATCTATGGAATTTTATCAAAGTTTGGTGCTGGAGCATTTCTGTTGGTTCAAGTGGTCTTGTTATTAGATGCTACTCATAACTGGAATGATTCATGGGTTGAGAAGGATGAAAAAAAATGGTGTGCTCAGCATCTTTTCTATGCATTTGCCTTTGTACATCGCACTGCTTGTCATATCAATCGTGTGTTATATTGCTACATACGCCTTCTCAGGAATCTGTTCATTTGGTTTAATCCATCTGGTCATGATTGTGGACTAAATGTGTTCTTCATCGTTGTGCTGATGATCCTTGCCTTTATATTTGCTATTATTGCTTTACACCCTGCAGTAAATGGCAGCCTTTTACCAGCATCTGTTATATCGGTATACTGTGCTTATGTTTGTTACACGGGTCTCTCTAGCGAACCACGTGACTATGTGTGCAATGGACTTAACAAATCCAAGGCAGTTGATGCCAGTACTCTCATCCTCGGAATGCTCACTACCGTCCTCTCTGTTCTATACTCCGCTCTCCGAGCTGGCTCATCCACCACACTCCTTCCAACAAGTAGGGAGGAATCATTGTTAGAGGACCCTGAAGATGGAAATAAGAAGAGTGGTGAAACCGAGGCACGGCCTGTGAGCTACTCATACTCATTCTTCCATATAATCTTTGCACTTGCCAGCATGTACGCTGCAATGCTTCTCTCAGGATGGACAGACTCATCAGAGAGTGCATCTCTGATCGATGTCGGATGGACTTCGGTTTGGGTCAAGATATGCACTGGTTGGGTCACGGCTGGACTCTACATATGGACACTCATTGCACCACTCGTCCTTCCGGATCGTGAGTTCTACTAA


· Genomic location:


scaffold291:1587974:1588721:-