Information for Lmscaffold291.52

· Gene Ontology:


GO:0003677 GO:0005634 GO:0006355


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


Cupin_3/PF05899; DUF946/PF06101; SAP/PF02037; Kunitz_legume/PF00197; Peptidase_M41/PF01434; S1FA/PF04689; NTC2/PF10358; PPR_2/PF13041; AAA/PF00004


· Interpro information:


Lmscaffold291.52


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
310.317596.115281.296267.239


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (73 aa)


>Lmscaffold291.52
MAEEFPGNIESKGLNPGLIVLLVIGGLLVTFLVGNFILYTYAQKNLPPKKKKPVSKKKLKKEKLKQGVPVPGE


· CDS sequence: (630 bp)


>Lmscaffold291.52
ATGATGCATCGTCGTACGAATAGTGATCAAACGGATTTAACGACGTCTACGAATGATTACGGAGTGAAAACAGGAGTTGTTACCGGTGGAGGAGGAAGATTCTCCGTCGGTGTTGGTGGTGGTGTTGGTGCGGATAGTATGGTGAATGGTGGTTCGCTTTGTAATTCTGATATTGGACCATCAGCGTCTGTGGTTGCGGCTGCGATTGCGCAAGGGCTTTATCATAGACAGAAAACAGCGGTTGCGGTTAATAGTCTTAACGAGGACGCGAGTTCGATTCTCGAAGGGAAAACAGAAGGAATTGAGCTTAGAGTTGAGCGATGGAGAGCAGAGAAAAAAGGAGCGTTTGCGGTTGAAGCGGCTGGAGATAGCGATGAGTCTAGTAGAGGAGGAGCTGGGAAGAGACGGAGGAGGAGGAGAAAGGAGAAGCAACAACGGCGGAGGAATGGTGGTGGAGTAGAGAGTAAGAAAGGTTTGTTTTCATGTTTTGGAAACGTTTTTGGATGTGAAATTTCGATAACTTGTGGTGGTGGAAGCGGCGGAGATGGAGACAGCACAAAGAAGAGATATAATAAGAATAAAGTAGCAAATCTTAGTGCTGTAGACGAAACGTTTAGTTCTGCGATTTGA


· Genomic location:


scaffold291:256959:258100:+