Information for Lmscaffold339.868

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


B3/PF02362


· Interpro information:


Lmscaffold339.868


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0.7032873.506800


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (208 aa)


>Lmscaffold339.868
MVTSWKTKARVTTTSHRRQPQDPESPVKKFCKMILPSTMKSNMMRIPPRFVKLHGSKLSDVVTLETPAGFKRSIKLKRIGKEIWLGEGWTEFAKAHSIEIGHFLMFEYIENSSFRVIIFDVSASEINYPLDAVDISDSDDEVIDVTDKVFLGSQCTSENYQFHGGYSEHQPKGTERDIDFNKILHELDVMSSVQVLNEEEKDKRAYKG


· CDS sequence: (1413 bp)


>Lmscaffold339.868
ATGAGCTCGATTTATCCTGGACAAAGATTTCTTTCTTTATTGGATAAGAATTTGAAAACTGTAATTCAAGCTAAACAAATCCATGCTCAATCGGTCATCAACGGCTACCTGGATAATTCTCTTCTCGGTAAACTCGTAGGCCATTACTGTTCGAAACCATCTACTGAAAGCTCCAAGCTTGCTCATTTACTGGTATTCCCTCGACTTGGTCATCCCGACAAGTTTCTCTTCAACACATTGCTTAAGTGTAGCAAACCAGATGACTCTATTCGGATTTTCGCCAATTGGGCATCAAAAAGTTCGTTGCTTTCACTCAATGAGCGTACGTTCGTCTTCGTCCTTGGTGCTTGTGCTAGGTCAACTTCGTCGGCGTTATGGGTTGGTAAAATTGTTCATAGTATGGTGATGAAGCTTGGGTTCCTCCATGAATCTGAATTGATTGGAACTACTTTACTTCATTTCTACGCTAAGAATGGGGATTTAAGTTATGCAAGGAAAGTGTTTGATGAAATGTCTGACAGAACCTCTGTTACATGGAACGCAATGATCAGTGGATATTGTTCACATAAAGACAAAGGGAACCAGAATACCAGAAAGGCTTTGATTCTGTTTCGGAGATTTGCCAGCTGCGGTAATGAAATTAGACCTACTGATACAACCATGGTTTGTGTTCTTTCAGCTATTTCTCAGACAGGTTTGCTTGAAATCGGCTCTCTCGTTCATGGTTACATCAAGAAACTCGGTTTTACACCTGAAGTTGATGTATTAATTGGTACTGGACTTGTCGATATGTACTCAAAATGTGGCTGCTTAAACAGCGCATTCTCAGTCTTCGAGCAAATGAAAGTGAAGAATGTCTTGACATGGACTTCAATGGCAACAGGGCTAGCTCTCAACGGAAGAGGATATGAAACACCGAATCTCCTAAACCAAATGGTGGCATCTGGGATTAAACCAAACGAAGTAACTTTCACTAGTTTGCTTTCGGCTTATCGACACATAGGTCTTGTTCAAGAGGGAGTCGAGTTGTTTCTGAGCATGAAGACAAGATTCGGTGTCACTCCAGTCATACAACACTACGGATGCATAGTAGATCTTCTAGGTAAAGCAGGGCTGATACAAGAGGCTTATGAGTTTGTATTAGCTATGCCTATAAAACCGGATACTATCTTGTTAAGAAGTCTCTGCAATGCCTGCAGCATTTATGGAGAGACTGTACCGGGTGAAGAGATTGGTAAAGCTCTTCTCAAGATAAAACGAGAGAAGGAGAAGCGTTCAGCTTCTGAATGCGAAGATTATGTTACTTTATCGAATGTATTAGCTCATAAAGGAAAATGGGTAGAGGTAGAGAAGCTGAGGAACGAGATGAAAGAACGAAGAATCAAAACAAGACCTGGTTCTAGTTTTGTTTAA


· Genomic location:


scaffold339:4921470:4922429:-