Information for Lmscaffold344.226

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


no information


· Interpro information:


Lmscaffold344.226


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (145 aa)


>Lmscaffold344.226
MIDKRVESSYTPYAMSTILAQSSTIWWKRTHTLNTSAPKLGEEAARVKGDERLKTELEKDQNENKVLKSKIEQLEKDNASLKSDLTSKAGEHDGLKLRYNKLRRSNDALKADHEKLRASIEPTSARLSGAGKRIEGSARPSSRHT


· CDS sequence: (210 bp)


>Lmscaffold344.226
ATGGCGAAAGCATCAGAGCATAAACAAGACTTGGCCGTTGTAGTGGAAGAGACTAAGCTTGATATCCGCGACGTAGTCCACTCAACCATCACTTACGGTGAGGATAACCAAAACAGTGTCGGGAGACGTAATGACGTGGCAATGGTTGTTATAAGAGCCATGTGCATGACCGTATCGACGGTGGCTGACGTTAATGATGACAGCCCATGA


· Genomic location:


scaffold344:2288674:2289266:+