Information for Lmscaffold353.260

· Gene Ontology:


GO:0003700 GO:0005667 GO:0007049


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


E2F_TDP/PF02319; DP/PF08781


· Interpro information:


Lmscaffold353.260


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
6.813226.582135.225533.93886


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (290 aa)


>Lmscaffold353.260
MEMDLFRTPEIQRHHPSVSLTKTPVRRKLIVDDDNEVGSEKKGQSRTTGGGLRQFSVMVCQKLEAKKITTYKEVADEIISDFATIKQNSEAAMNDNDYNEKNIRRRVYDALNVFMALDIIARDKKEIRWKGLPITCKKDVQEVKMDRDKIMSSVQKKAAFLKELREKVSSLENLMSRNQKMVVKTEGPAEGFSLPFILLETNPHAVVEIEISEDMQLVHLDFNSTPFSVHDDAYILKLMQEQKQQQNRVSSSSSSHYQSQHSSALSSSSSCIASGTSGPVCWNSGSIDTR


· CDS sequence: (1080 bp)


>Lmscaffold353.260
ATGGAAAAGCTAGTGGAGGCTTTGCATTTCATCTGCTCAATTGATTTCTGGAGGATGGCTCTGTTTTGGAACATGGCCCTCATCTTTTCTTACTTTCAATTGCTTAAAAGATGGATATTTGGCTATAAATCTTCTTCCTTCAATCATTCATGGAGTACTTCACACAAATCTGTTTGTGTTATCACTGGCGCTACTTCAGGCCTTGGTAAGGCGACTGCGTTTGCTCTTTCAAGGAAGGGTTTCTACGTTGTTCTTGTTGGACGATCCTCCCACTTACTATCAAAGACGTTGAGTGAAATTAAGAGGCAGAATGAGGATGCTCAACTCAAAGCTTTTGAAGTTGACCTGTCGTCTTTTCAATCAATTTTGAAGTTCAGGAACTCTTTCGAGCAGTGGCTTTTAGAATCAAATTTACATTCTTCTATCCAGCTTTTAGTGAACAATGCTGGAATAATGGCAACCTCAAGTTGGCCGACTTTTGAAGGCTTTGACAGGATGATTGCTACAAATTATGTTGGTGCTTTCTCTTTAACCAAACTTCTCTTACCGCTCCTCAATAACAGCCCTGTGCCTTCACGAGTCATAAATGTTACATCTTTTACACATCGTTCTGCTTCTGCTGGGAGGTTTGACAAGGATTCAGTTACTGGAGTGAACTTTTCGAGATTAAAGCAATATCCTTGGAGTAGTATCTATGAATATTCCAAACTTTGCCTTCTATTTTTCTCTTACGAGCTGCATAGACAACTTCGACTCACGGATGATTCACATCACGTCTCTGTTGTAGCGGTAGATCCAGGAGCAGTAAAAACAAACATAATGCATGAGCTTCCTTTATATATACAAGTCTTGGCGTTCTTTGGCCTCAACATTCTTAGACTATTGCAGTCCCCAGAGGATGCAGCTGCAGTTGTCATTGATGCTGCTTTAGCTCAACCTGAAATATCAAGTAAATACTTCTTTGGAGGAAATGGAAGGACCATTGAATCTTCAGCACTTTCTTGTGACCCGAAACTTGCTAAGGAACTCTGGGACACATCATGTATTGTATTTAACGAATTGCTCCAAACACACACTTGA


· Genomic location:


scaffold353:1253687:1255611:+