Information for Lmscaffold356.203

· Gene Ontology:


no information


· KEGG information:


K09287: -


· Enzyme Commission number (EC):


no information


· Gene family:


AP2/PF00847; B3/PF02362


· Interpro information:


Lmscaffold356.203


· Expression data: (root) (FPKM)


2500m3000m3500m4000m
0000


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (308 aa)


>Lmscaffold356.203
MGSGGSSIVVDLENGVETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQEEAARSYDIAARRFRGRDAVVNFKTSLTVEADDELAFLEAHSKAGIVDMLRKHTYADELAQNNKRRFLSPDGKRNTYQNDNVLKARQVLFQKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSLTMTKGVLINFEDLTGKVWRFRYSYWNSSQSYVLTKGWSWFVKEKNLKAGDVVSFEKSTAPDQQFYIDWKPRAGSSQKPVKVMVRLFGVDIFNETTDKPNDVVVTCGGKRSRDVDDICLRYGVLRCRR


· CDS sequence: (330 bp)


>Lmscaffold356.203
ATGTGTTATGGGCATGAGGTAACATTCAATAGAATCACTGAAAATTACAACATAATTCTTGACTACTACAAAGGCGGTGCTCTTAGCCCCAGATGTTTATTCCAAGACATGCAAGTGAAGGAACTGGCTCGGGACATTCTCAAAGGGATATCAGACATCCATGCAGCAGGCATTGTTCACTACGATATTAACCCAATGAACATCTTGTTGTATGAGCCGAGACCGAGAACTTGGAGACTCAGTGGATATACACCTTTGATCACTGACTTCGAGTCAGCGATGGAGAGTGGGTCCACTGGCTATCCCGATTGGCCAGCGCATACGACGTAA


· Genomic location:


scaffold356:1670476:1671402:+