Information for Lmscaffold433.675

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


bZIP_1/PF00170; bZIP_2/PF07716


· Interpro information:


Lmscaffold433.675


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (317 aa)


>Lmscaffold433.675
MDKEKTPAPPSGGLPPPSGRYYAFSPNGSSFAMKAESSFPPLNPSGSSSDANRFSHDISRMPDNPPKKIGHRRAHSEILTLPDDLSFDSDLGVVGAADGPSFSDETDEDLLYMYLDMEKFNSSATSTSQMGEPSEPAGKNELGSTSHLQSTLGSSSERPRIRHQHSQSMDGSSTIKPEMLMSGNEDVSGVDSKKAISAAKLSELALIDPKRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLSIENNELKLRVQSMEQQVHLQDALNDALKEEVQHLKKENMTSSPDLEAPLTKE


· CDS sequence: (897 bp)


>Lmscaffold433.675
ATGTCATTATCAGCATCGGAGAAGGAGGAAAACCACCGGAAAATGGCGGCGGATAAGGCTGAGATAGTGAAGAAGAAGAGATCAATGTGGGAAAGAAAATGGAGGAGATTAGATATTGTGAAAGCATTTGCTTCACTCTTTGTGCATTTTCTTTGTCTCTTGGCTCCTTTTAATTTCACTTGGCCTGCTTTAAAAGTTGCCCTAATTGTCTATACAATTGGTGGCCTTGGAATCACTGTCTCTTACCACCGTAACTTAGCTCACCGGAGCTTTAAAGTTCCTAAATGGCTTGAGTATTTCTTCGCTTACTGTGGCCTTCTTGCCATTCAGGGAGATCCGATTGATTGGGTGAGTACACATCGATACCATCACCAGTTTACAGATTCCGATAGAGACCCACATAGTCCTAATGAAGGTTTTTGGTTTAGTCATCTCCTTTGGTTATTTGATACCGGTTATCTCGTTGAAAAGTGTGGAGGACGTAACAATGTGATGGACTTGAAGCAACAATGGTTCTATAGGTTTCTTCGAAACACAATTGGTCTTCACATCTTAACTTTTTGGACCCTCGTCTATCTTTGGGGAGGGCGTAGGAGAGCAATTGGTTACCATGGGACTTGGCTCATAAATTCAGCATGTCATATTTGGGGTTCGCAAGCCTGGAACACTAAGGACACCTCTCGTAACATTTGGTGGCTAGGACTATTCACTATGGGAGAGAGCTGGCACAACAACCACCATGCCTTCGAGGCGTCAGCTCGGCATGGACTAGAATGGTACCAGGTTGATATCACTTGGTACCTCATTTGCTTCTTCCAGGCTCTTGGTTTAGCCACCAATGTCAAATTGCCTACTGATGCTCAGAAACGCAAGATGGCTTTCCCTCGTAAATCTTAA


· Genomic location:


scaffold433:3803856:3806286:+