Information for Lmscaffold467.520

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


FLO_LFY/PF01698


· Interpro information:


Lmscaffold467.520


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (368 aa)


>Lmscaffold467.520
MDPQGFPSGLFRWNPTRAIVPAPPPVHQPPQQPAPTPQTAAYGMRLGDLEGLFGPYGIRFYTAAKIAELGFTASTLVDMKDEGLEEMMNSLSHIFRWELLVGERYGIKAAVRAERRRLQEEEEEEASRRRHLLLSAAGDSGAHHALDALSQEGLSEEPVQQQDQTDAAGNNGGGDGGGGGYWEIGQAGKIKKQQQQQRRRKKTMIMTSVETDDDGNEGEDDDGMDHNGNGSGVLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCCEFLIQVQTIAKDRGEKCPTKCYALHCLDEDASNALRRAFKERGENVGSWRQAYYKPLLRQLCHLERNGAVAATAALVGGISCSGSSASGHGGDDMHY


· CDS sequence: (1773 bp)


>Lmscaffold467.520
ATGTACAGTGCCCAAACTCCTGTGTTCTTGGCAAATCAGACTAAAGTATATGATCATTTAATTCCATTGCATAAACCCTTGATTTCTCTTCGAAACTCGGTTTCCCAATCCTTCCCTATGTGGAGAAACATTGCTAAACAAGCAATTTCTAGGTCATCAGCTCGATTAAACGTCTGTTCCCAAACTCGTGGTTCGCTTTCATTTCCTCAGGATTCTTCTAGTCTTTCGAAAATTTTGATATTTCGGTTTTCGGTGTTCTGTTCCAACTCGGACTCAGGATGTCACGAATTGGGTATTCGTTGTTTAAGTGGCATCACGAGATCAGCAGCTCTTTCCGGGCGAGTCGGGTTGGGATTCTCCAAGGAAGAGGGCTCCCTTAACGGGTCTTTGGCTAGAGGGATATGGAGCAGTGGTGGATGTGCTGCTGATCTGGTGGATCGCAGCGATGTTCCTTTATTGGAAAAGCCTGATACTGAAGATGAGGGCATTCTTAGGAAATGGAAGTGGGAAGTCAAATCTGCTAAAAAGCAGAACAGCGAGAGACATTCTCTGCGCTGTGACACAGAACTCAAGCTTTCGGTAGCACGGAAAATGAAAGATGAGGAAGGTTTTTATTATCCCCACAATGTTGACTTCCGAGGACGTGCATATCCCATGCCCCCACACTTAAATCATCTGGGTTCTGATTTGTGTCGGGGTGTTTTAGAATTTGCTGAGGGAAGGCCTTTTGGGAGTTCAGGATTACGATGGCTGAAAATACATTTAGCAAACTTGTATGCTGGTGGTGTAGATAAGTTATCACTTGAGGGACGGCTCGCTTTTACCGAAAATCACTTGGATGACATATTTGATTCGGCAGACAGACCACTTGAAGGAAGAAGATGGTGGCTGCAGGCTGAAGACCCATTTCAGTGCTTGGCTTTAGGAGCAGAAGCTGTTAACTTAGTTGCAGGTGAGAAGCCAGCAGATGTTTATTCAGGAATAGCTACCAGGGTTCTTAATATTATGCGCCGAGATGCAGACAGAGATCCTGAAGGTTTTCCTGAAGCATTACGTGCAAGAAAATTACTAAACGAGGTGGATCGGAAGCTTGTAAAGCAGACAGTTATGACATCAGTCTATGGTGTCACCTATATTGGTGCTCGGGATCAAATAAAGAGAAGGTTGAAGGAGCGCAGTTCATTTAATGATGAAAAAGAAATTTTTGGGGCGGCTTGTTATGCAGCAAAGGTAACGTTAAATGCTATAGATGAGATGTTTCAAGCTGCACACGCCATCATGCATTGGTTTGGTGAATGTGCAAAGATTATTGCGTCAGAAAATGAAACAGTTCGATGGACAACACCATTAGGTCTTCCTGTTGTACAACCTTACCACCAAATGGGAACGAAACTCGTAAAGACATCCCTCCAGACCTTATCGCTCCAGCGTGAAACTGATAAGGTCATTGTCAGGCGACAGAGGACAGCCTTTCCTCCAAATTTTATTCACTCCCTCGACGGGTCTCATATGATGATGACTGCAGTTGCATGCAAAAAAGCAGGCGTGTGTTTTGCAGGAGTTCATGACTCATTTTGGACACATGCGTGCGATGTAGATAAATTAAACAGAATACTACGAGAAAAGTTTGTTGAACTGTATTCGCAACCCATATTAGAGAATTTGCTGGAGAGCTTTGAGCAATCGTTTCCTCATTTAGAATTTCCTCCCCTGCCCGAACGAGGAGATTTGGATTTAAAAGTGGTGTTAGATTCACCTTATTTTTTCAACTGA


· Genomic location:


scaffold467:4108565:4111312:-