Information for Lmscaffold52.232

· Gene Ontology:


no information


· KEGG information:


K14431: TGA; transcription factor TGA


· Enzyme Commission number (EC):


no information


· Gene family:


bZIP_1/PF00170; DOG1/PF14144; bZIP_2/PF07716


· Interpro information:


Lmscaffold52.232


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (371 aa)


>Lmscaffold52.232
MNSTSTHFVPPRRVGIYEPLHQIGMWGESFKSNISNGGMNTPSHIIIPNNQKLDNNNNNLSEDTSHGTAGTPHMFDQEACTSRNPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIQLEQELDRARQQGFYVGNGIDTTPLGFSETMNPGIAAFEMEYGHWVEEQNRQICELRTVLQGHVNDIELRLLVENAMKHYIELFKMKSTAAKADVFFVISGMWRTSAERFFLWIGGFRPSDLLKVLLPHFDILTDQQILDVCNLKQSCQQAEDALSQGMEKLQHTLADCVAGGQLGEGSYIPQVNSAMERLEALVGFVNQADHLRHETLQQMYRILTTRQAARGLLALGEYFQRLRALSSSWATRHREPT


· CDS sequence: (255 bp)


>Lmscaffold52.232
ATGGGAAGTAGCGAAGAGACACCAGTGGTTCTCATTACAGGATGTTCTCAGGGAGGAATTGGCCATGCGTTGGCTCGTGAATTCTCAGCGAATGGTTGTCGAGTGGTGGCGACGAGTCGATCACAGAAGACGATGGCTGATTTGGAGGAAGATCCTAAGTTTTATGTGCAAGAGCTTGATGTTCAATCAGAGCAAAGTGTGAATAAAGTTGTGTTGAAAGTTATTGAGAAATTTGGTCAGATTGATGTCTTGTAA


· Genomic location:


scaffold52:1191960:1193917:+