Information for Lmscaffold520.8

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


AAA_29/PF13555; DUF588/PF04535; Peptidase_C48/PF02902; Hpt/PF01627; ATHILA/PF03078; Lipase_GDSL/PF00657; ABC_tran/PF00005; B3/PF02362; Nup35_RRM/PF05172; Nup35_RRM_2/PF14605; RRM_1/PF00076; Jacalin/PF01419; PDR_assoc/PF08370; DUF4539/PF15072; ABC_trans_N/PF14510; AAA_21/PF13304; Myb_DNAbinding/PF00249; ABC2_membrane/PF01061; AAA/PF00004


· Interpro information:


Lmscaffold520.8


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (110 aa)


>Lmscaffold520.8
MGRNMGFDKVKEERKMLSFFKIFQSEDLSSESMRAFPHNVILGISKKDFSFKMEIRAQWGMKWEVEISKNPRFYYMEKRGWDKFVNENALGENEFITFTHRENELFCPHL


· CDS sequence: (267 bp)


>Lmscaffold520.8
ATGAAGAATCATCTCTCCGAGCCTGGGATTTTTACACCATCTTCGTACGTGTCTTCAGTCCGTAATAATCCTGACTTTAAAGCTGGTAATGATACAGAGATGATTGATCTCACTGGAGCAACAAAGCGAGGAGTCACATCTCGCAGATCTGGTGTTCGCAAACGAATCATTAAACAGGAGTCTAACCCTAATCCAAGAAAAACCCGACGAGTCATTAAAAACAGAAATGGCGTCGAATTTCTCCAAAAAGTTTTCATCGGAAGTTGA


· Genomic location:


scaffold520:80518:80945:+