Information for Lmscaffold554.79

· Gene Ontology:


no information


· KEGG information:


K09060: -


· Enzyme Commission number (EC):


no information


· Gene family:


bZIP_1/PF00170; MFMR_assoc/PF16596; MFMR/PF07777; bZIP_2/PF07716


· Interpro information:


Lmscaffold554.79


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (352 aa)


>Lmscaffold554.79
MSSNEEGYSTKSDKPSQTTPEQSNNVHVYHHDWAAMQGYYGTGVALPQFYNSNVATGHAPPPYMWPPHSPMMAPYGTPYPPFCPPGGVYAHPGVQMSSESQGPVSQASPVTATPLNMDAPANSTGNTEHGFMKKLKEFDGLAMSISNNNTEIAEHSSSEHRSSQSSEINGSSNPSDGNTTGGEQSKRKRRLEGSPDIVGKPSSQLSPKPAAVAVAAVMPSAIDFQNSAGIPQAWNEKEVKKEKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMTLRSKLSQLNVESEKLRLENETLLDRLKVAGQTQATDKTENLISQVDKNNSVSGSKNMQHQLLNTPVTDPVAAN


· CDS sequence: (255 bp)


>Lmscaffold554.79
ATGAAGCAATTCAAAGTTAAAGTCGACGAGTCACATTCTTCAAACCAACCAGGATCAAAGACATTATCATCTAAAGATGTTTTTGGAAAATCGTTATACACATTTTATATTGGCCAAAACGATTTCACATCTAATTTAGCTACTATTGGAGTTGATAGAGTGAAACAATGCCTTCCTCAAGTCATTGGCCAAATTGTCTCGAACCATCAAGGTATGAGACATAGTATTAAAGCTTGTTGTGGTTGCGGTGGATGA


· Genomic location:


scaffold554:359091:361120:+