Information for Lmscaffold60.7

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


tRNAsynt_His/PF13393; Sigma54_activat/PF00158; OTU/PF02338; RuvB_N/PF05496; PPR_3/PF13812; AAA_25/PF13481; RPM2/PF08579; TIP49/PF06068; AAA_16/PF13191; ATP13/PF12921; 1cysPrx_C/PF10417; AAA_33/PF13671; PPR_2/PF13041; DP/PF08781; PPR_1/PF12854; RNA_helicase/PF00910; HGTP_anticodon/PF03129; ABC_tran/PF00005; AAA_2/PF07724; Med4/PF10018; C1_2/PF03107; DUF1884/PF08967; CDC48_N/PF02359; Myb_DNAbinding/PF00249; Acylphosphatase/PF00708; AAA/PF00004; IstB_IS21/PF01695; AAA_22/PF13401; AAA_5/PF07728; Parvo_NS1/PF01057; TPR_14/PF13428; CDC48_2/PF02933; ECSIT/PF06239; E2F_TDP/PF02319; PPR/PF01535; Mg_chelatase/PF01078; AAA_18/PF13238; PPR_long/PF17177


· Interpro information:


Lmscaffold60.7


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (290 aa)


>Lmscaffold60.7
MEMDLFRTPEIQRHHPSVSLTKTPVRRKLIVDDDTEVGSKKKGQSRTAGGGLRQFSVMVCQKLEAKKITTYKEVADEIISDFATIKQNSEAAMNDNEYNEKNIRRRVYDALNVFMALDIIARDKKEIRWKGLPMTCKNDVQEVKMDRDKIMSSVQKKAAFLKELREKVSSLENLISRNQKKVVKTEGPAEGFSLPFILLETNPHAVVEIEISEDMQLVHLDFNSTPFSVHDDAYILKLMQEQKQQQNRVSSSSSTHYQSQHSSALSSSSSCIASGTSGPVCWNSGSIDTR


· CDS sequence: (1224 bp)


>Lmscaffold60.7
ATGGTTGCTTCAGCCGCCGCAAGACCCCTTGTCACCGTCCAAGGACTCGTCGGTGACATGACTACCGATCAATCTACCACCGTCACTTTACCCGACGTCATGACTGCTCCTGTTCGACCAGATATCGTCAACTTCGTCCACGCCCAAATCTCAAACAATAGTCGTCAGCCTTATGCAGTCTCCAAAAAAGCCGGTCATCAAACCTCTGCTGAGTCATGGGGAACCGGAAGAGCTGTGTCGCGTATTCCTCGTGTTCCCGGTGGTGGTACTCACCGTGCCGGTCAAGCAGCGTTCGGAAACATGTGTCGTGGTGGTCGTATGTTTGCTCCGACTAAGATCTGGCGTCGCTGGCATCGTCGTGTCAATGTCAACATGAAGAGACACGCAATTGTTTCTGCAATCGCCGCTACTGCTGTTCCAGCTCTTGTGATGGCTCGTGGACACAAGATTGAGAATGTTCCTGAGATGCCTCTTGTTGTCAGTGACTCAGCTGAGGCTGTGGAGAAGACATCAGCTGCGATTAAGGTATTGAAGCAGATCGGTGCTTATGACGATGCGGAGAAAGCTAAGAACAGTATTGGAATCCGTCCTGGTAAGGGTAAAATGAGGAACCGTCGTTACATTTCTAGGAAAGGTCCTCTAATTGTGTATGGAACTGAAGGATCCAAGATTGTGAAAGCATTTAGGAATCTTCCTGGTGTTGAGCTTTGTTATGTAGAGAGGCTTAATTTGTTGAAATTAGCTCCTGGTGGTCACCTTGGTAGATTTGTCATTTGGACTAAGTCAGCTTTTGATAAGCTTGAGTCTATCTATGGCTCATTTGAGAAACCTTCTGAGAAGAAGAAGGGATATGTCTTGCCTCGTTCAAAGATGGTGAATGCTGATCTTGCTAGGATTATTAACTCTGATGAGGTTCAAAGTGTGGTGAAGCCGATTAAGAAGGATGCTAAGAGAGCTGTTCTTAAGAAGAACCCATTGAAGAACCTTAATGTGATGCTTAAGTTGAATCCTTATGCTAAGACTGCTAAGAGGATGTCTCTGTTGGCTGAAGCTCAAAGGGTTAAGGCTAAGAAGGAAAAACTCGAGAAGAAGAGGAAGGTCGTCACTAAGGAGGAAGCACAAGCGATTAAAGCAGCAGGCAAGGCATGGTACCAGACTATGATCTCTGACAGTGATTACACCGAGTTTGATAACTTCTCCAAGTGGCTCGGATCTAGTCAGTAA


· Genomic location:


scaffold60:32208:34107:-