Information for Lmscaffold75.52

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


RRM_7/PF16367; AAA_22/PF13401; Pkinase_Tyr/PF07714; Pkinase/PF00069; Alliinase_C/PF04864; Pec_lyase_C/PF00544; B3/PF02362; Metallophos/PF00149; AAA_2/PF07724; RRM_1/PF00076; RuvB_N/PF05496; MA3/PF02847; DNA_pol3_delta2/PF13177; Aminotran_1_2/PF00155; Beta_helix/PF13229; Auxin_resp/PF06507; AAA/PF00004


· Interpro information:


Lmscaffold75.52


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (666 aa)


>Lmscaffold75.52
MINVMNPMIGGSEKGLDPQLWHACAGGMVRMPPKNSKVFYFPQGHAENAYDCVDFGNMPIPPMVLCCVQAIKYMADTESDEVFAKLRLIPMKNDDFVDHEYEGCEDSNGFESNSEKTPSFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYNAEPPVQTILAKDVHGDVWKFRHIYRGTPRRHLLTTGWSNFVSQKKLVAGDSIVFMRAENGDLCVGVRRAKRGGVGNGPEYSAGWNPIGGSCGYSSLLKEDECNTLRRSNCSIADRKGKVTAESVIEAATRAISERPFEVVYYPRASTSEFCVKALDARAAMRIPWCSGMRFKMAFETEDSSRISWFMGTVSAVNVCDPIRWPNSPWRLLQVGWDEPDLLQNVKRVNPWLVELVSNVHPIPLTSFSPPKKKLRLPQHPDYNNLMNSISVPSFPSNPLIRSSPLSSVLDNVPVGLQGARHNAHQYYGDLQHYYLNRPPPPPPSSSLPRSPSLGLRNIHRKNEKGFCFLTMGTTPCTDTESKKSHIVLFGKLILPEDQLSEKGSTDTANIEKTQISSGGSNQNCVAGRELSSSDEGSPCSNKVHDGAGLETGHCKVFMESDDVGRTLDLSGIGSYAELESKLSNMFGIQKSEMLSSVLYRDASGATKYAGNEPFSDFSKTARRLTILSEQGSESVVI


· CDS sequence: (1455 bp)


>Lmscaffold75.52
ATGCATGCGATTGATCTCAAAGAGTTTCAGGAAAAGTTCTCTAATGGATTCCGTCCTTGGCAACGATCGTTTCAGTTCTGGGTTCGTGCCACCGATATCTACATTGGATACAAGGTATTCGAACTTCGAATGAATCTCGTCAAGGATGTGAAGAAACAGGAAGATATGTGGGAAACACAACATGAACTTGCTGCTCAAAAGATTTATTCTATGTGCTCTGACCTTGGCGGCTTCTTCCTTAAGATTGCACAAATTCTAGGGAAACCTGACATGGCTCCAGCTGCATGGGTCAAAAAACTAGTCACTTTGTGTGATCAAGCTCCTGCTACACCATTCGATGCCATTCGAGTTGTCCTGGAGAAAGAGTTAGGTAAAAGTATCGATGAAGTGTTTGAAACATTTGATGATAAACCTCTTGGGTCTGCTTCTATTGCTCAGGTACACCGAGCAAGAGTAAAGGGTGAAAAAAGGGATGTTGTTGTAAAGGTCCAACATCCGGGCGTTGAGAAACTGATGATGATAGATATAAGAAACTTGCAAATATTTGCATTATACATGCAGAAAACAGATGTTAAATTTGACTTGTTATCTGTAACAAAGGAAATCGAGAAGCAGATTGGCTATGAGTTCGACTTCAAAAGGGAGGCCAATGCAATGGAAAAGATCCGATGTTTTCTTTATGATAACAATAAAAAGAGTCCTGTTCTGGTTCCCAGGGTGCTGCCACATTTAGTGACCAGGAGGGTTCTGGTTATGGAATACATTAACGGAATCCCGATCTTGACCCTCGGAGATGAAATGGCCAAAAGAGGGATAAATCCTCGTGGTAAAATGGCAGAGAGAGCAAAATTCAATATACTTCACAGTTTGTCCCAAGCATATGGCCAAATGATACTGAAGAGTGGTTTATTTCATGCGGATCCACATCCTGGGAATATCTTGATTCGTAAAATTGTAATCTTGTTAACACGTCATCAGGTTGCACTGCTGGACTATGGCCAAGTGAAGGAACTCCCTGACCACCTGAGACTTGGCTATGCAAATTTGGTCATTGCCATGGCTGATAACAATGCCTCATTGGCATTACAGAGCTTTAGGGAACTCGGAATAGATACAGTTGCCAAGTGTGTGAATGAGGAACAAGAACTTCTCCGTTTAGCACAAACAATGTTTGACACAAATATGCCTCCTGGAACCACAGTTCTGCAACCTTTCTCAGAAGACGCTTCGATCAAAAAGATTTCGGTTGAGGCATTTCCAGAGGAATTGTTCTCTGTTCTACGAACAGTAATTCTGTTAAGAGGACTCAACGTTGGAATTGGACTTAATTATTCCTGCGCTCAACACTGGAAGCCTATTGCAGAAGAGGCTTTGCGTGCAGCAGGAAGATTCTCAACAGGTGGAAAGCAGAAACGTCCTTGTAGTTATCTGAGAAGGTTATACCCAAGGCCATGA


· Genomic location:


scaffold75:322893:325065:+