Information for Lmscaffold77.66

· Gene Ontology:


GO:0003677 GO:0006355


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


FLO_LFY/PF01698


· Interpro information:


Lmscaffold77.66


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (414 aa)


>Lmscaffold77.66
MDPQGFASGLFRWNPTRAIIPAPPTVHQPPQQPAPTPQTAAFGMRLGGLEGLFGPYGIRFYTAAKIAELGFTASTLVDMKDDELEEMMNSLSHIFRWELLVGERYGIKAAVRAERRRLQEEEEASRRRHLLLSVAGDSGAHHALDALSQEGLSEEPVQQQDQTGNNGGGDGAGGYWEIGQAGKMKKQQRRRKKTMMTSVETDDDGNEGEDDDGMDHNGNGSGVLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLIQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNVVAATAALVGGISCSGSSASGHGGDDMHY


· CDS sequence: (1251 bp)


>Lmscaffold77.66
ATGAAGCTTTCGAGCTGGGTTTTGATCTTCCTTGTTTCTAACCTTACCTTCTCGACGATTTCTGCTTTTCGTTTGAGTCGGAGTCAACCGACTGAGCGAATTTCAGGTAGTGCTGGTGATGTGTTGGAAGATGATCCAGTGGGAAGATTGAAAGTCTTTGTTTATAAGCTTCCAAGCAAATACAATAAGAAAATACTTCAGAAGGACCCTAGATGTCTCAACCACATGTTTGCTGCTGAGATCTATATGCAACGGTTTCTTTTGTCCAGCCCAGTTCGAACGCTTAATCCCGAGGAAGCTGATTGGTTCTATGTCCCAGTTTACACCACTTGTGATCTCACACCTAACGGGCTTCCTCTGCCCTTTAAATCCCCCCGAATGATGAGAAGTGCCATTCAGCTCATTGCTTCTAACTGGCCATACTGGAATTGCACGGAAGGAGCTGACCACTTCTTTGTTGTGCCTCATGACTTTGGAGCCTGTTTCCATTATCAAGAAGAGAAAGCAATAGGAAGAGGAATACTACCCTTGCTTCAACGGGCTACACTAGTGCAGACATTTGGACAGAGGAATCATGTTTGCTTGAAAGAGGGTTCAATTACTGTTCCTCCGTATGCTCCACCACAGAAGATGCAGTCACACTTGATTCCCGAAAAAACTCCTCGATCCATCTTCGTTTATTTCAGAGGATTATTTTATGATGTGGGAAATGACCCCGAGGGTGGCTATTATGCTAGGGGTGCTAGAGCAGCTGTATGGGAAAACTTCAAAGACAATCCTTTGTTCGATATCTCAACAGAACACCCAACAACATATTATGAAGACATGCAGAGAGCAATATTCTGCTTGTGCCCACTTGGATGGGCCCCATGGAGTCCAAGATTGGTGGAAGCCGTGATCTTTGGTTGCATCCCTGTGATCATAGCAGATGACATCGTGTTACCATTTGCAGATGCAATCCCTTGGGAAGATATTGGTGTGTTTGTAGATGAGAAGGATGTTCCTTACTTGGACACAATACTCACATCGATTCCACCCGAGGTTATATTGAGGAAACAGAGGTTGTTGGCAAACCCGTCGATGAAACAGGCGATGCTGTTCCCGCAACCGGCTCAACCAGGGGATGCGTTTCATCAGGTGTTGAACGGGTTGGCTCGTAAGCTGCCTCATGAGAAGAGTGTGTATCTGAGACCAGGTGAGAAGCTGTTGAACTGGACGGCCGGACCTGTCGCTGATCTGAAACCTTGGTGA


· Genomic location:


scaffold77:325235:327986:+