Information for Lmscaffold774.1

· Gene Ontology:


GO:0003700


· KEGG information:


K15683: -


· Enzyme Commission number (EC):


no information


· Gene family:


Ferric_reduct/PF01794; KOW/PF00467; Rft1/PF04506; zfRING_11/PF17123; 2OGFeII_Oxy/PF03171; KIP1/PF07765; TUDOR/PF00567; Ribosomal_S4e/PF00900; Pectinesterase/PF01095; FNIP/PF05725; Amidase/PF01425; EFhand_8/PF13833; Cuoxidase/PF00394; SNase/PF00565; Cyclin/PF08613; DS/PF01916; ELFV_dehydrog_N/PF02812; SPARC_Ca_bdg/PF10591; IQ/PF00612; PX/PF00787; LRR_6/PF13516; PRA1/PF03208; DUF4005/PF13178; EFhand_1/PF00036; RRM_5/PF13893; Cuoxidase_2/PF07731; AP2/PF00847; RRM_1/PF00076; Vps5/PF09325; 40S_S4_C/PF16121; FHA/PF00498; Fbox/PF00646; Pkinase_Tyr/PF07714; Response_reg/PF00072; DUF620/PF04788; Copine/PF07002; Pkinase/PF00069; Sulfotransfer_1/PF00685; zfrbx1/PF12678; Rhomboid/PF01694; PRT_C/PF08372; ATS3/PF06232; ANAPC4_WD40/PF12894; EamA/PF00892; TPT/PF03151; HIRAN/PF08797; Transferase/PF02458; DUF863/PF05904; RNase_T/PF00929; Cuoxidase_3/PF07732; DAO/PF01266; PTEN_C2/PF10409; Ank_5/PF13857; DnaJ/PF00226; LRR_4/PF12799; NAF/PF03822; Myb_CC_LHEQLE/PF14379; CBFD_NFYB_HMF/PF00808; RRM_2/PF04059; DUF810/PF05664; K_oxygenase/PF13434; LRR_8/PF13855; zfRING_2/PF13639; Sulfotransfer_3/PF13469; ELFV_dehydrog/PF00208; NADPH_Ox/PF08414; p450/PF00067; mTERF/PF02536; Pyr_redox_2/PF07992; TAXi_N/PF14543; Ank_2/PF12796; FH2/PF02181; DUF773/PF05600; Pyr_redox_3/PF13738; S4/PF01479; TyrDNA_phospho/PF06087; TPX2_importin/PF12214; Ank/PF00023; START/PF01852; Glyco_transf_34/PF05637; Mito_carr/PF00153; NAM/PF02365; DIOX_N/PF14226; eIF2A/PF08662; ResIII/PF04851; Cyclin_N/PF00134; RINGv/PF12906; Helicase_C/PF00271; HNH/PF01844; UAA/PF08449; WD40/PF00400; NAD_binding_8/PF13450; Ank_3/PF13606; EFhand_6/PF13405; Ank_4/PF13637; Kinaselike/PF14531; Asp/PF00026; bZIP_1/PF00170; EFhand_7/PF13499; Cu_bind_like/PF02298; TAXi_C/PF14541; Tryp_alpha_amyl/PF00234; Calreticulin/PF00262; LRR_1/PF00560; zfNFX1/PF01422; RS4NT/PF08071; FAD_binding_2/PF00890; UDPGT/PF00201; NAD_binding_6/PF08030; SNF2_N/PF00176; bZIP_2/PF07716; FMOlike/PF00743; Oleosin/PF01277; C2/PF00168; PMSR/PF01625; DUF617/PF04759; EFhand_5/PF13202; DOG1/PF14144; Myb_DNAbinding/PF00249; IPK/PF03770; LOR/PF04525; Pyr_redox/PF00070; WRKY/PF03106; LRRNT_2/PF08263; CaM_binding/PF07839; HI0933_like/PF03486; Glyco_hydro_79n/PF03662; FAD_binding_3/PF01494


· Interpro information:


Lmscaffold774.1


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (881 aa)


>Lmscaffold774.1
MAGSVVTEFRWKSPPQAPPQNENVFSDSDSDSGSDSESHQNRHNDLSNSIFKAYLDCHSSSSPSSIELAKIQSFLASSSSGAVSCLICLERIKRTDPTWSCTSLCFAVFHLFCIQSWARQCLDLQAARAVTRPSSNSIEPEAVWNCPKCRSSYNKLEIPRRYVCYCGKEEDPPSDNPWILPHSCGEVCERPLSNNCGHCCLLLCHPGPCASCPKLVKAKCFCGGVADVRRCGHKQFSCEDVCERLLDCDIHKCREICHDGKCPPCRERAVYKCCCGKVKEEKDCCERVFRCDSPCENMLSCGKHVCERGCHSGECGLCPYQGKRSCPCGKRFYQGLSCDVAAPLCGGTCDKLLGCGYHRCPERCHRGPCLETCRIVVTKSCRCRGSKKQVPCHQDLACERKCQRVRDCGRHACRRRCCDGECPPCSEICGKKLRCRNHKCQSPCHQGPCAPCPIMVTISCACGGTHFEVPCGTETNQKPPRCRKLCHITPLCRHGQNQKPHKCHYGACPPCRLPCDEEFPCGHKCTLRCHGPRSPPNREFMIKPTKKMLNIQPEATPGSPCPSCPELVWRPCVGHHLAAERMMVCSDRTQFACDNLCGNPLQCGNHYCLFACHPLEIKSSSLDKRSESCEKCDLCCQKERTPKCQHPCPRRCHPGDCPPCKTLVKRSCHCGAMAHAFECIYYNTLSEKDQSKARSCCGPCHRKLPNCTHLCPEICHPGQCPLPEKCGKKVVVRCKCLTLKKEWICQDVQAAHRATGSDPKEVLKHQFGVGLLPCDSNCKSKLQVAGSVLQQRNVKETEEKEEPSGKNATKRRKRRERGQDIKETTRLQKLAASTKRVLMVVMLMALLLAVSYYGYKGLLWLSDWMNELEEKRQKSRRYPRF


· CDS sequence: (945 bp)


>Lmscaffold774.1
ATGACTTCAATGCAATCTATGATACCACCCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCTCTAGATGAACAGAAGAATCACCTAAATGCAATCTACGACAGCACACTAAGTTTCCTTAGCTCACTTTCTCGTTTCACTGAGCATTACATAACGTTGAACTTAGCTAATGGAGATCCCTTGTGTAGAAGTATGATATGA


· Genomic location:


scaffold774:11965:16319:-