Information for Lmscaffold830.98

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


B3/PF02362


· Interpro information:


Lmscaffold830.98


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (359 aa)


>Lmscaffold830.98
MDLSLAPTTKTSSDQEQDKDQELTSNIGASTSSGTGNNTNLPMMMIPPREREHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDSSNNQNGTLLNFQDRNGKMWRFRYSYWNSSQSYVMTKGWSRFVKEKKLVAGDIVSFQRGIGDESERYKLYIDWRHRPDMSIVQAHQFGNFGFNFNFPTTSQYSNRFHLLPEYNSVPIHRNLSIGNHQRSYYNNQRQELVRYGPYSYGNLAGRCYYTGSPLDQRNIIGSEPLVIKSVPVVPGRLTPVIIPPLPQPPSTSGKRLRLFGVNMECGNDYNQQQESWILPRGEIGASSSSSPALRLNLSXXXXXXXXXXXXXXXXXAKKGKSSFSLNFNP


· CDS sequence: (1896 bp)


>Lmscaffold830.98
ATGATCGAGAGGCGCAGCAGACTCTGGGAACCATGCAGCATCAGAAATTTATTAGAAGATAAATGTGTTCAGGGCAGTGAAGAAATCGAAGGCATGTTTCTGGACACATCAAACTTAAGCTTCTCTCTCAAGCCTGCTGCCTTTGAGAATATGCTGGACCTTAGATTGCTCAAGATTTACTCTTCCGATCCTGAAAATTATCCGAAGACCAACTTCAAATGCTCTCTCCATTCTCTTCCTGATGAACTAAGACTCCTCCATTGGGAGAACTATCCTGTGCAACATTTTCCACAATATTTTGATCCTAGGCATCTTGTTGAAATCAACATGCCGTACAGTCAACTTCAGAAACTTTGGGGTGGAACAAAGAACCTGGAAATGTTGAGGACAATCAGGCTCTGTCATTCCCAGCAACTAGTAAATATCCACGATCTTCAAAATGCTCAAAATATTGAGGTAATCGATCTCCAAGGATGTACAAAACTACAGAGTTTCCCAGCCACAGGTGAAATGCTGCATCTACGAGTTTTAAATCTCTCAGGTTGCACAGAGATCAAAAGTCTCTTAGATATTGCACCAAATATTGAGATCTTGCATTTACAGGGCACTGGTATAAAAGAATTACCACTCTCCATTGTCAAGCCAAACTACAGCGAGATATTTAATCATCTAGCTAAAATCCAGGGTCTTTCAGGTGTCTCAAACCTTGAAACTGATCTCAAATCTTTTATTAATATGCAAATGAGCAAGTCTAGTCTAGATCTTGGCAAGCTTATTTGCCTGGACCTGAAAGATTGTTCTCGTTTGGAAAGTCTGCCAGATATGGTTAATTTAGGTCTTCTTAGAGTTCTTGATCTTTCGGGTTGTTCAAAGCTCCAGACTATTCAGGGTTTCCCTCGGAACCTGAAAGAGTTAAATATTGCTGGCACTGCAGTAAGACAATTGCCACACCTTCCTCAAAGTTTAGAACTCTTTAACGCACATGGTTGTTTTGATCTATCTCCAGAAGTGCTCAACGACTTTTTAGTGAAAGCGCTGGCTAATGTAAAACACATGCCAAGAGAACTTGAACAGGAAGTCAATGAAGCTCCAGCTTTCAGTTTCTGTCCGCCTTCACATAGAAATCTAAATTCCAGACTTCATATACAACCAGGATATTCTGTAATGATAAGACTAGATACTTCTTTTAGGAATTCGCTTGTGGGCTTTGCTATGCTTGTGGAAGTTACATTTTCAGAGGATTACGATACAGGTTTCGACGTTATATGTGTTTGTAGATGGAGAAACAAGGAAGGCCACTCTCATATGAAAGAAAGGAATTTAGATTGTTGGGCTCCGGGTAAAGTTGACCCAGAACATCAAAACAATCATATATTTGTCTTCATTGATGTCAACATGCGTCCAAGTACTGATGATGACTACAACATCTGGGGTGATTTAGTTGTTTTTGAGTTCTTCCCAGTCAACAAGCAGAAAAAGTCTCTACAGAATAGTTGCAGAGTGACAGGATGTGGAGTCCGTGTAATAAATGCTGAAAGTGATTCAAGTCTTGAAAATATAATACCAGTTTTGTCCTTGGATCCGAAGGAGATTTCTGGTAATGAAGTTGAAGAAGAATTGCTTAGGGCCAATTATGATGGCTTACAGGAGAACGATAAAGTTATGTTTCTTTACATAGCGTGTTTGTTCAATGACGAGGATGTTGGTTATGTTGCTCCGGTTATTGCTAGCAATATGGACTTGGACAAAGGGATTGGTTTTGATGTTAACATAGACCGGGCCCGGTTTAAGATTGGATGGCGGCTGAACCGACCACCTGGCTATTCTGATTTTCTGATTCTCCAAATCTTATTCGGATCTTCTCCATTTGGATTTAAGCCGGTGGGGTTCTGCTAA


· Genomic location:


scaffold830:500897:501976:+