Information for Lmscaffold89.19

· Gene Ontology:


no information


· KEGG information:


no information


· Enzyme Commission number (EC):


no information


· Gene family:


UAA/PF08449; Myb_DNAbind_6/PF13921; Pkinase_Tyr/PF07714; Ribosomal_S8/PF00410; Pkinase/PF00069; MMR_HSR1/PF01926; bZIP_2/PF07716; RRM_1/PF00076; Myb_DNAbinding/PF00249; zfC2H2_4/PF13894; Arf/PF00025; Roc/PF08477; zfC2H2_6/PF13912; EamA/PF00892; bZIP_1/PF00170; DUF966/PF06136; CBFD_NFYB_HMF/PF00808; Histone/PF00125; Ras/PF00071; Gtr1_RagA/PF04670


· Interpro information:


Lmscaffold89.19


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (172 aa)


>Lmscaffold89.19
MQPQTDVFSLNNYLNSSIPSPYSSHFPISTPFATNSVTLSHIYGLQSPTIYPQSMSLSSNNSTSDDAEEQQTTKNVINERKQRRMISNRESARRSRMRKQGHLDELWSQVMSLRIENHQLLDKLNNLSESHDKVLQENAQLKEETFELKQVIGDMQIQSPFSCFRDDITTIE


· CDS sequence: (789 bp)


>Lmscaffold89.19
ATGGAAAGCTTTGTGTATTTCCTTGTCGGCTTCTTCCTCTTTTCTTCATCTGTAAATGCTTGTGATCGATGTCTTCACCATTCTAAAGCTCCTTATTTTTCCTCTGCTTCTGCTCTTTCTTCTGGAGCGTGTGGTTATGGCTCTATGGCTACGACTTTCTTCGCCGGACACATTGCAGCGGCTGTACCTTCAATCTACAAAGATGGTGCTGGTTGTGGAGCTTGCTTCCAAGTTAGATGTAAGAACCCTAAGTTGTGTAGCACCAAAGGAACAACAGTAATGGTAACTGATTTGAACAAGAGTAATCAAACCGATCTTGTACTTAGTAGCAGAGCCTTTAGGACTATGGCTAATGTTGGTGCTGATAAAAATCTTCTCAAACAAGGCCTTGTCGATATTGAATACCACAGAGTTCCTTGCGATTACGGGAACCAAAACCTGCACGTTAGAGTGGAAGAAGCAAGCAAAAAGCCATACTATTTACAGATAAAGCTTTTGTATCAAGGAGGTCAAACAGAAGTGGTAGCTATAGACATTGCTCAAGTGGGTTCATCGCGTTGGAGTTACATGACCAGAAGTCATGGAGCTGTGTGGAAGACTGATAAAGTACCAACTGGAGCTATTCAATTCAGGTTCGTTGTGACTGGTGGATACGATGGAAAGATGGTTTGGTCGCAGAGAGTTCTTCCGGCTAATTGGGAATCTGGCAAGACTTATGATGCTGGTGTTCAAATCTCTGACATTGCTCAAGAAGGCTGTGATCCATGTGACGATCACATCTGGAAATAA


· Genomic location:


scaffold89:173074:173592:+