Information for Lmscaffold93.700

· Gene Ontology:


no information


· KEGG information:


K09287: -


· Enzyme Commission number (EC):


no information


· Gene family:


AP2/PF00847; B3/PF02362


· Interpro information:


Lmscaffold93.700


· Expression data: (root) (FPKM)


2500m3000m3500m4000m


· Simple Sequence Repeat (SSR) data:


SSR nr.SSR typeSSRsizestartend


· Protein sequence: (343 aa)


>Lmscaffold93.700
MDSSCIDEISPSNNSECLLATATKFSPLQAPAALRLYRMGSSRSSIVVDLENGVETESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEQDEAARSYDIAARRFRGRDAVVNFKTPLTVEADDELAFLEAQSKAEIVDMLRKHTYADELAQSNKRKFLNPDGTGKHQNDRVLKAREVLFQKAVTPSDVGKLNRLVIPKQHAEKHFPLPSPSLTVTKGVLINFEDLTSKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDVVSFEKSTGPDQQLYIDWKPRAGSSQKPAKVVVRLFGVDIFNVTAISHCGGKRSRDVDDMFALRCSKKQAIINVL


· CDS sequence: (1398 bp)


>Lmscaffold93.700
ATGGCTACCTTTGGTGCGGCTGCTACCGCCAACACTAACCCTAACAAATCCTACGAGGTTACTCCATCACCCGGAGATTCTATTTCGAGCTTAAGTTTTAGTCCAAGAGCCGATATACTTGTGGCCACTTCATGGGACAATCAGGTGAGGTGTTGGGAAATATCGCGTAATGGAGCTAATATAGCCAGTGCTCCGAAAGCATCAATATCGCATGATCAGCCAGTTTTGTGTTCTGCTTGGAAAGATGATGGAACCACAGTCTTTACCGGTGGATGTGATAAACAAGCAAAAATGTGGCCCTTGTTGTCAGGTGGTCAACCTGTAACTGTTGCTATGCACGATGCTCCTATTGTAGCTCTGGCCTGGATCCCAGGAATGAATCTCCTAGCAACTGGAAGTTGGGATAAAACATTGAAATATTGGGACACCAGACAGGCAAATCCTGTGCATACCCAACAGCTCCCTGATAAATGCTATGCATTGTCTGTGAAGCATCCTCTGATGGTTGTTGGGACTGCCGATAGAAATCTGATAGTCTTCAACTTGCAAAATCCTCAGACTGAGTTCAAGAGAATTCAATCACCACTGAAGTACCAGACGAGGTGTGTTACTGCCTTCCCTGATCAGCAAGGATTTCTGGTTGGTTCAATTGAGGGACGGGTTGGCGTCCATCATCTGGATGATTCTCAACAGAGCAAAAACTTTACATTCAAATGCCACAGAGATGGCAATGATATCTACTCTGTCAACTCTCTGAATTTCCACCCGGTACATGGCACTTTTGCCACTGCTGGCTCTGATGGTGCTTTCAACTTCTGGGATAAGGATAGTAAACAGAGACTCAAGGCCATGTCAAGGTGCAATCAGCCAATTCCTTGCAGTTCATTCAATCACGATGGGTCTATATATGCATATGCGTCCTGCTATGACTGGAGCAAAGGTGCAGAAAATCACAACCCGGCAACTGCGAAAAGCAGCATTTTCTTGCACATGCCACAGGAAGTCGAGGTTAAGGCAAAACCAAGAGTTGGAGCAACAGGTACCTGTATCCGGCGAATCGGGTCACGAGTCGGATTATATAAATACTCGCGGGTACGAGCCAGGTCATGGGTCGGATGTAACGAATGCAGGTTTGATCCGTTATCCGGTTCGTTAGTTGATTTGGCGGATACCCGCGGATACGGGCCGGGTCACGGGTCGGAACAAGCCGAGTCGGGTAATGGCAGGGTATCTGAATATGAAGCGGGTACCTGGCGGGTCGGGTATGGAGAACGAGTACCGTTGGGTACGAGGCGGGTCACGGGTCGGCCAAAACATGGGCGGATACCCGTTTTGAACGAACCGGGTCATAGGTCGAAAAAAAATTTACCCACCTTCGACGGGTCGGATAACGGGTAG


· Genomic location:


scaffold93:4481855:4482886:+